General Information

  • ID:  hor006275
  • Uniprot ID:  Q5CZK2
  • Protein name:  Relaxin-3 A chain
  • Gene name:  RLN3
  • Organism:  Pan troglodytes (Chimpanzee)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DVLAGLSSSCCKWGCSKSEISSLC
  • Length:  24(119-142)
  • Propeptide:  MARYKLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADGDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGALRGSRDVLAGLSSSCCKWGCSKSEISSLC
  • Signal peptide:  MARYKLLLLLAVWVLTGELWPGAEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play a role in neuropeptide signaling processes. Ligand for LGR7, RXFP3 and RXFP4 (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP3
  • Target Unid:   H2QQQ6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q5CZK2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006275_AF2.pdbhor006275_ESM.pdb

Physical Information

Mass: 287427 Formula: C101H167N27O36S4
Absent amino acids: FHMNPQRTY Common amino acids: S
pI: 6.1 Basic residues: 2
Polar residues: 13 Hydrophobic residues: 7
Hydrophobicity: 40.83 Boman Index: -1557
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 81.25
Instability Index: 5897.08 Extinction Coefficient cystines: 5750
Absorbance 280nm: 250

Literature

  • PubMed ID:  16136131
  • Title:  Initial sequence of the chimpanzee genome and comparison with the human genome.
  • PubMed ID:  15707501
  • Title:  Evolution of the relaxin-like peptide family.